Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Lefty-B Recombinant Protein Antigen

Recombinant protein antigen

Manufacturer:  Novus Biologicals™ NBP233505PEP

Catalog No. NBP23505PEP

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

Recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lefty-1.

Source: E. coli

Amino Acid Sequence:AQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTC

Specifications

Specifications

100 μl
RUO
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit