Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LETM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | LETM1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159611
|
Novus Biologicals
NBP159611 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
LETM1 Polyclonal specifically detects LETM1 in Human samples. It is validated for Western Blot.Specifications
| LETM1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| LETM1 and EF-hand domain-containing protein 1, mitochondrial, leucine zipper-EF-hand containing transmembrane protein 1, Leucine zipper-EF-hand-containing transmembrane protein 1, Mdm38 homolog | |
| LETM1 | |
| IgG | |
| Protein A purified | |
| 60 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 3954 | |
| Synthetic peptides corresponding to LETM1(leucine zipper-EF-hand containing transmembrane protein 1) The peptide sequence was selected from the middle region of LETM1. Peptide sequence MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title