Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LETM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen LETM1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP159611
View Documents
Novus Biologicals
NBP159611
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

LETM1 Polyclonal specifically detects LETM1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

LETM1
Polyclonal
Purified
RUO
LETM1 and EF-hand domain-containing protein 1, mitochondrial, leucine zipper-EF-hand containing transmembrane protein 1, Leucine zipper-EF-hand-containing transmembrane protein 1, Mdm38 homolog
LETM1
IgG
Protein A purified
60 kDa
Western Blot
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
3954
Synthetic peptides corresponding to LETM1(leucine zipper-EF-hand containing transmembrane protein 1) The peptide sequence was selected from the middle region of LETM1. Peptide sequence MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit