LIN9 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179424

Catalog No. NBP179424

Description

LIN9 Polyclonal specifically detects LIN9 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LIN9
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_775106
• Gene Symbols: LIN9
• Immunogen: Synthetic peptide directed towards the N terminal of human LIN9The immunogen for this antibody is LIN9. Peptide sequence SLQKTPVWKGRNTSSAVEMPFRNSKRSRLFSDEDDRQINTRSPKRNQRVA.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 286826
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BARA, BARPsv, hLin-9, huLin-9, Lin-9, lin-9 homolog (C. elegans), pRB-associated protein, protein lin-9 homolog, rb related pathway actor, TGS1, TGSBeta subunit-associated regulator of apoptosis, TUDOR gene similar protein, Type I interferon receptor beta chain-associated protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 64 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.