Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LIN9 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17942520UL

 View more versions of this product

Catalog No. NBP17942520


Add to cart

Description

Description

LIN9 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

LIN9
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
BARA, BARPsv, hLin-9, huLin-9, Lin-9, lin-9 homolog (C. elegans), pRB-associated protein, protein lin-9 homolog, rb related pathway actor, TGS1, TGSBeta subunit-associated regulator of apoptosis, TUDOR gene similar protein, Type I interferon receptor beta chain-associated protein
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
286826
Western Blot
Western Blot 1:1000
Affinity Purified
LIN9
Synthetic peptide directed towards the N terminal of human LIN9The immunogen for this antibody is LIN9. Peptide sequence TRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVA.
53 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit