Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LINC00521 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17959420UL

 View more versions of this product

Catalog No. NBP17959420


Add to cart

Description

Description

LINC00521 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

LINC00521
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
c14_5713, C14orf48, chromosome 14 open reading frame 48, DKFZp434O1910, MGC33356
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
256369
Western Blot
Western Blot 1:1000
Affinity Purified
LINC00521
Synthetic peptide directed towards the N terminal of human C14orf48The immunogen for this antibody is C14orf48. Peptide sequence MDTGQRADPSNPGDKEGDLQGLWQELYQLQAKQKKLKREVEKHKLFEDYL.
16 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit