Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LINGO-2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | LINGO-2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB123943
|
Novus Biologicals
NBP309521100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
LINGO-2 Polyclonal specifically detects LINGO-2 in Human samples. It is validated for Western Blot.Specifications
| LINGO-2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| LERN3FLJ31810, leucine rich repeat and Ig domain containing 2, leucine-rich repeat and immunoglobulin-like domain-containing nogoreceptor-interacting protein 2, Leucine-rich repeat neuronal protein 3, Leucine-rich repeat neuronal protein 6C, LRRN6Cleucine rich repeat neuronal 6C | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human LINGO-2 (NP_689783). Peptide sequence ILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 158038 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title