Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LINGO-2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen LINGO-2
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123941
View Documents
Novus Biologicals
NBP309520100UL
100 μg
Each for $320.71
Add to cart
 
NB123942
View Documents
Novus Biologicals
NBP30952025UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

LINGO-2 Polyclonal antibody specifically detects LINGO-2 in Mouse samples. It is validated for Western Blot
Specifications

Specifications

LINGO-2
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
158038
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Mouse
LERN3FLJ31810, leucine rich repeat and Ig domain containing 2, leucine-rich repeat and immunoglobulin-like domain-containing nogoreceptor-interacting protein 2, Leucine-rich repeat neuronal protein 3, Leucine-rich repeat neuronal protein 6C, LRRN6Cleucine rich repeat neuronal 6C
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse LINGO-2 (NP_780725). Peptide sequence KTILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNG
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit