Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lipase A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP247397
Description
Lipase A Polyclonal specifically detects Lipase A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Lipase A | |
Polyclonal | |
Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Acid cholesteryl ester hydrolase, Cholesteryl esterase, EC 3.1.1, EC 3.1.1.13, LALCESDcholesterol ester hydrolase, Lipase A, lipase A, lysosomal acid, cholesterol esterase, lysosomal acid lipase, lysosomal acid lipase/cholesteryl ester hydrolase, Sterol esterase | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
LIPA | |
This antibody was developed against a recombinant protein corresponding to amino acids: FALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEF | |
0.1 mL | |
Lipid and Metabolism | |
3988 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Product Content Correction