LIPJ Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170602

Catalog No. NBP170602

Description

LIPJ Polyclonal specifically detects LIPJ in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LIPJ
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: bA425M17.2, FLJ11218, lipase J, lipase member J, lipase, family member J, lipase-like abhydrolase domain-containing protein 1, lipase-like, ab-hydrolase domain containing 1, LIPL1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 142910
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: LIPJ
• Immunogen: Synthetic peptides corresponding to LIPJ(lipase, family member J) The peptide sequence was selected from the C terminal of LIPJ. Peptide sequence LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Equine: 92%; Bovine: 91%.
• Target Species: Human, Rat, Bovine, Equine, Rabbit
• Isotype: IgG