Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LIR-6/LILRA1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309438100UL
Description
LIR-6/LILRA1 Polyclonal specifically detects LIR-6/LILRA1 in Human samples. It is validated for Western Blot.Specifications
LIR-6/LILRA1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
CD85 antigen-like family member I, CD85i, CD85i antigen, leukocyte immunoglobulin-like receptor subfamily A member 1, leukocyte immunoglobulin-like receptor subfamily A member 1 soluble isoform, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 1, LIR-6Leukocyte immunoglobulin-like receptor 6, LIR6MGC126563 | |
The immunogen is a synthetic peptide directed towards the middle region of Human LIR-6/LILRA1. Peptide sequence FGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAY | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
11024 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction