Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LOC100047915 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP174243
Description
mediator of cell motility 1 Polyclonal specifically detects mediator of cell motility 1 in Mouse samples. It is validated for Western Blot.Specifications
| LOC100047915 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| similar to Memo1 protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| LOC100047915 | |
| Synthetic peptides corresponding to the N terminal of LOC100047915. Immunizing peptide sequence SGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPS. | |
| 100 μL | |
| Signal Transduction | |
| 100047915 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title