Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LOC100359876 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309228100UL
Description
LOC100359876 Polyclonal specifically detects LOC100359876 in Rat samples. It is validated for Western Blot.Specifications
LOC100359876 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Rabbit | |
Affinity purified | |
RUO | |
100359876 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
The immunogen is a synthetic peptide directed towards the middle region of Rat LOC100359876 (XP_002727568). Peptide sequence NDSWRLWPSGDRSQEKDKQSYRDLKEVTPEGLQMVKKNFEWVADRVELLL | |
100 μg | |
Primary | |
Rat | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction