Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LOC390338 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191527

 View more versions of this product

Catalog No. NBP191527

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

LOC390338 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

LOC390338
Unconjugated
PBS & 2% Sucrose. with No Preservative
LOC390338 similar to T-box 20 isoform a
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
390338
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
Affinity Purified
LOC390338
Synthetic peptide directed towards the middle region of human LOC390338. Peptide sequence RESVESLIQKHSNAPSPIRTYGGEEDVLGDESQTTPNRGSAFTTSDNLSL.
25 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Porcine: 86%; Rat: 86%; Equine: 86%; Human: 86%; Guinea pig: 86%.
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit