Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LOC641515 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | LOC641515 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP170608
|
Novus Biologicals
NBP170608 |
100 μL |
Each of 1 for $436.00
|
|
Description
MGAT4EP Polyclonal specifically detects MGAT4EP in Human samples. It is validated for Western Blot.Specifications
LOC641515 | |
Polyclonal | |
Rabbit | |
Human | |
LOC641515 uncharacterized LOC641515 | |
LOC641515 | |
IgG | |
Affinity Purified | |
40 kDa |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
641515 | |
Synthetic peptides corresponding to LOC641515(hypothetical protein LOC641515) The peptide sequence was selected from the C terminal of LOC641515. Peptide sequence FWTHNISIGNHLTVILNHPANLSRVQVMTGSIVEWEVRPGEGAGGAGLPT. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title