Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LOC645015 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | LOC645015 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170612
|
Novus Biologicals
NBP170612 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
LOC645015 Polyclonal specifically detects LOC645015 in Human samples. It is validated for Western Blot.Specifications
| LOC645015 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| asparagine-linked glycosylation 1-like 8, pseudogene, LOC645015 asparagine-linked glycosylation 1 homolog pseudogene | |
| LOC645015 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 645015 | |
| Synthetic peptides corresponding to LOC645015(similar to mannosyltransferase) The peptide sequence was selected from the middle region of LOC645015. Peptide sequence LPSLVCVITGQGPLTEYYSRPIHQKHFQHIQVCNPWLEAEDYPLLLGSVD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title