Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LOC728566 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191381

 View more versions of this product

Catalog No. NBP191381

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.



LOC728566 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


PBS and 2% Sucrose with 0.09% Sodium Azide
LOC728566 zinc finger protein 729-like
Immunogen affinity purified
Western Blot
Western Blot 1:1000
Affinity Purified
Synthetic peptide directed towards the N terminal of human LOC728566. Peptide sequence MIVHTGEKHYKCQECIKAFKVHAEEKHYKCQECGKAFKKSLDLNVHKIIH.
21 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit