Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

LONRF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155072

 View more versions of this product

Catalog No. NBP155072



Description

Description

LONRF1 Polyclonal antibody specifically detects LONRF1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

LONRF1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
LON peptidase N-terminal domain and ring finger 1, LON peptidase N-terminal domain and RING finger protein 1, RING finger protein 191, RNF191FLJ23749
Rabbit
IgG
Protein A purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Purified
LONRF1
Synthetic peptides corresponding to LONRF1(LON peptidase N-terminal domain and ring finger 1) The peptide sequence was selected from the N terminal of LONRF1. Peptide sequence MSSPAVARTSPGGSREMAPAPQGRGRFWEVGGGSGHRLERAAAESERWEL.
46 kDa
100ul
Zinc Finger
Primary
91694
Human, Mouse, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit