Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LONRF2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15929520UL
Description
LONRF2 Polyclonal specifically detects LONRF2 in Human samples. It is validated for Western Blot.Specifications
LONRF2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q1L5Z9 | |
LONRF2 | |
Synthetic peptides corresponding to LONRF2(LON peptidase N-terminal domain and ring finger 2) The peptide sequence was selected from the middle region of LONRF2. Peptide sequence IGISRFRVLSHRHRDGYNTADIEYLEDEKVEGPEYEELAALHDSVHQQSV. | |
20 μL | |
Zinc Finger | |
164832 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
FLJ45273, LON peptidase N-terminal domain and ring finger 2, LON peptidase N-terminal domain and RING finger protein 2, MGC126711, Neuroblastoma apoptosis-related protease, RING finger protein 192, RNF192MGC126713 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title