Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LONRF2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen LONRF2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15929520
View Documents
Novus Biologicals
NBP15929520UL
20 μL
Each for $152.22
Add to cart
 
NBP159295
View Documents
Novus Biologicals
NBP159295
100 μL
Each for $436.00
Add to cart
 
Description

Description

LONRF2 Polyclonal specifically detects LONRF2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

LONRF2
Polyclonal
Rabbit
Zinc Finger
FLJ45273, LON peptidase N-terminal domain and ring finger 2, LON peptidase N-terminal domain and RING finger protein 2, MGC126711, Neuroblastoma apoptosis-related protease, RING finger protein 192, RNF192MGC126713
LONRF2
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q1L5Z9
164832
Synthetic peptides corresponding to LONRF2(LON peptidase N-terminal domain and ring finger 2) The peptide sequence was selected from the middle region of LONRF2. Peptide sequence IGISRFRVLSHRHRDGYNTADIEYLEDEKVEGPEYEELAALHDSVHQQSV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit