Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LONRF3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen LONRF3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155065
View Documents
Novus Biologicals
NBP155065
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

LONRF3 Polyclonal specifically detects LONRF3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

LONRF3
Polyclonal
Rabbit
Zinc Finger
LON peptidase N-terminal domain and ring finger 3, LON peptidase N-terminal domain and RING finger protein 3, MGC119463, MGC119465, RING finger protein 127FLJ22612, RNF127
LONRF3
IgG
Affinity Purified
84 kDa
Western Blot
Unconjugated
RUO
Q496Y0
79836
Synthetic peptides corresponding to LONRF3(LON peptidase N-terminal domain and ring finger 3) The peptide sequence was selected from the N terminal of LONRF3. Peptide sequence QPPPPLRVNVVLSGLLGKLFPGPARASQLRHEGNRLYRERQVEAALLKYN.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit