LONRF3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154834

Catalog No. NBP154834

Description

LONRF3 Polyclonal specifically detects LONRF3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LONRF3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q496Y0
• Gene Symbols: LONRF3
• Immunogen: Synthetic peptides corresponding to LONRF3(LON peptidase N-terminal domain and ring finger 3) The peptide sequence was selected from the middle region of LONRF3. Peptide sequence LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: LON peptidase N-terminal domain and ring finger 3, LON peptidase N-terminal domain and RING finger protein 3, MGC119463, MGC119465, RING finger protein 127FLJ22612, RNF127
• Host Species: Rabbit
• Molecular Weight of Antigen: 84 kDa
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 79836
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG