Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LONRF3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | LONRF3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154834
|
Novus Biologicals
NBP154834 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
LONRF3 Polyclonal specifically detects LONRF3 in Human samples. It is validated for Western Blot.Specifications
| LONRF3 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| LON peptidase N-terminal domain and ring finger 3, LON peptidase N-terminal domain and RING finger protein 3, MGC119463, MGC119465, RING finger protein 127FLJ22612, RNF127 | |
| LONRF3 | |
| IgG | |
| Affinity Purified | |
| 84 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q496Y0 | |
| 79836 | |
| Synthetic peptides corresponding to LONRF3(LON peptidase N-terminal domain and ring finger 3) The peptide sequence was selected from the middle region of LONRF3. Peptide sequence LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title