Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LPAR6/P2RY5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen LPAR6/P2RY5
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123916
View Documents
Novus Biologicals
NBP30950725UL
25 μg
Each for $106.19
Add to cart
 
NB123915
View Documents
Novus Biologicals
NBP309507100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

LPAR6/P2RY5 Polyclonal antibody specifically detects LPAR6/P2RY5 in Human samples. It is validated for Western Blot
Specifications

Specifications

LPAR6/P2RY5
Western Blot
Purified
RUO
Human
G-protein coupled purinergic receptor P2Y5, LAH3, LPA receptor 6, LPA-6, lysophosphatidic acid receptor 6, MGC120358, Oleoyl-L-alpha-lysophosphatidic acid receptor, P2RY5ARWH1, P2Y purinoceptor 5, P2Y5RB intron encoded G-protein coupled receptor, Purinergic receptor 5, purinergic receptor P2Y, G-protein coupled, 5
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LPAR6/P2RY5 (NP_005758). Peptide sequence GDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAK
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
GPCR
PBS buffer, 2% sucrose
10161
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit