Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRAT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | LRAT |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17977520
|
Novus Biologicals
NBP17977520UL |
20 μL |
Each for $204.00
|
|
|||||
NBP179775
|
Novus Biologicals
NBP179775 |
100 μL |
Each for $482.50
|
|
|||||
Description
LRAT Polyclonal specifically detects LRAT in Human samples. It is validated for Western Blot.Specifications
LRAT | |
Polyclonal | |
Rabbit | |
NP_004735 | |
9227 | |
The immunogen for this antibody is LRAT. Peptide sequence LEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDMGRTQKVVSNKRLILG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 2.3.1.135, LCA14, lecithin retinol acyltransferase, lecithin retinol acyltransferase (phosphatidylcholine--retinolO-acyltransferase), MGC33103, Phosphatidylcholine--retinol O-acyltransferase | |
LRAT | |
IgG | |
26 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title