Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRDD Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | LRDD |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157990
|
Novus Biologicals
NBP157990 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
LRDD Polyclonal specifically detects LRDD in Human samples. It is validated for Western Blot.Specifications
| LRDD | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| leucine-rich repeat and death domain-containing protein, leucine-rich repeats and death domain containing, MGC16925, p53-induced protein with a death domain, PIDDDKFZp434D229 | |
| Synthetic peptides corresponding to LRDD(leucine-rich repeats and death domain containing) The peptide sequence was selected from the middle region of LRDD. Peptide sequence RRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9HB75-3 | |
| 55367 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title