Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRIF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15665920UL
Description
LRIF1 Polyclonal specifically detects LRIF1 in Human samples. It is validated for Western Blot.Specifications
LRIF1 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q5T3J3 | |
LRIF1 | |
Synthetic peptides corresponding to C1ORF103 The peptide sequence was selected from the middle region of C1ORF103. Peptide sequence SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVT. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ligand-dependent nuclear receptor-interacting factor 1, RP11-96K19.1, C1orf103, ligand dependent nuclear receptor interacting factor 1, RIF1 | |
Rabbit | |
Affinity Purified | |
RUO | |
55791 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title