Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRIF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | LRIF1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15665920
|
Novus Biologicals
NBP15665920UL |
20 μL |
Each for $152.22
|
|
NBP156659
|
Novus Biologicals
NBP156659 |
100 μL |
Each for $436.00
|
|
Description
LRIF1 Polyclonal specifically detects LRIF1 in Human samples. It is validated for Western Blot.Specifications
| LRIF1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ligand-dependent nuclear receptor-interacting factor 1, RP11-96K19.1, C1orf103, ligand dependent nuclear receptor interacting factor 1, RIF1 | |
| LRIF1 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q5T3J3 | |
| 55791 | |
| Synthetic peptides corresponding to C1ORF103 The peptide sequence was selected from the middle region of C1ORF103. Peptide sequence SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title