Invitrogen™ LRIG3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579611

Catalog No. PIPA579611

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat testis tissue, HEPG2 whole cell.

May play a role in craniofacial and inner ear morphogenesis during embryonic development. May act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1.

Specifications

• Antigen: LRIG3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: LRIG3
• Gene Alias: leucine rich repeats and immunoglobulin like domains 3; leucine-rich repeats and immunoglobulin like domains 3; leucine-rich repeats and immunoglobulin-like domains 3; leucine-rich repeats and immunoglobulin-like domains protein 3; LIG3; LIG-3; LRIG3; RGD1561255; UNQ287/PRO326/PRO335
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 121227, 299830
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5 mg BSA and 0.05 mg sodium azide
• Gene Accession No.: Q6UXM1
• Gene Symbols: LRIG3
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human LRIG3 (428-465aa NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody
• Isotype: IgG