Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LRP2BP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen LRP2BP
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP170620
View Documents
Novus Biologicals
NBP170620
100 μL
Each for $436.00
Add to cart
 
NBP17062020
View Documents
Novus Biologicals
NBP17062020UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

LRP2BP Polyclonal specifically detects LRP2BP in Human samples. It is validated for Western Blot.
Specifications

Specifications

LRP2BP
Polyclonal
Rabbit
DKFZp761O0113, FLJ44965, LRP2 binding protein
LRP2BP
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
55805
Synthetic peptides corresponding to LRP2BP(LRP2 binding protein) The peptide sequence was selected from the middle region of LRP2BP. Peptide sequence RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit