Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRP2BP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | LRP2BP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170620
|
Novus Biologicals
NBP170620 |
100 μL |
Each for $436.00
|
|
NBP17062020
|
Novus Biologicals
NBP17062020UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
LRP2BP Polyclonal specifically detects LRP2BP in Human samples. It is validated for Western Blot.Specifications
| LRP2BP | |
| Polyclonal | |
| Rabbit | |
| DKFZp761O0113, FLJ44965, LRP2 binding protein | |
| LRP2BP | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 55805 | |
| Synthetic peptides corresponding to LRP2BP(LRP2 binding protein) The peptide sequence was selected from the middle region of LRP2BP. Peptide sequence RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title