Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRC20 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | LRRC20 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156883
|
Novus Biologicals
NBP156883 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
LRRC20 Polyclonal specifically detects LRRC20 in Human samples. It is validated for Western Blot.Specifications
| LRRC20 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ10751, FLJ10844, leucine rich repeat containing 20, leucine-rich repeat-containing protein 20 | |
| LRRC20 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8TCA0 | |
| 55222 | |
| Synthetic peptides corresponding to LRRC20(leucine rich repeat containing 20) The peptide sequence was selected from the middle region of LRRC20. Peptide sequence TTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALP. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title