Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRC49 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | LRRC49 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156473
|
Novus Biologicals
NBP156473 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
LRRC49 Polyclonal specifically detects LRRC49 in Human samples. It is validated for Western Blot.Specifications
| LRRC49 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ20156, leucine rich repeat containing 49, leucine-rich repeat-containing protein 49, PGs4, Tubulin polyglutamylase complex subunit 4 | |
| LRRC49 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8IUZ0 | |
| 54839 | |
| Synthetic peptides corresponding to LRRC49(leucine rich repeat containing 49) The peptide sequence was selected from the N terminal of LRRC49. Peptide sequence KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title