Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRC52 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP170625
Description
LRRC52 Polyclonal specifically detects LRRC52 in Human samples. It is validated for Western Blot.Specifications
LRRC52 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
LRRC52 | |
Synthetic peptides corresponding to LRRC52(leucine rich repeat containing 52) Antibody(against the N terminal of LRRC52. Peptide sequence QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC. | |
Affinity purified | |
RUO | |
440699 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
FLJ25811, leucine rich repeat containing 52, leucine-rich repeat-containing protein 52 | |
Rabbit | |
35 kDa | |
100 μL | |
Primary | |
Equine 75%, Canine 75%, Mouse 83%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction