Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRC52 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | LRRC52 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17062520
|
Novus Biologicals
NBP17062520UL |
20 μL |
Each for $152.22
|
|
NBP170625
|
Novus Biologicals
NBP170625 |
100 μL |
Each for $436.00
|
|
Description
LRRC52 Polyclonal specifically detects LRRC52 in Human samples. It is validated for Western Blot.Specifications
| LRRC52 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 440699 | |
| Synthetic peptides corresponding to LRRC52(leucine rich repeat containing 52) Antibody(against the N terminal of LRRC52. Peptide sequence QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ25811, leucine rich repeat containing 52, leucine-rich repeat-containing protein 52 | |
| LRRC52 | |
| IgG | |
| Affinity Purified | |
| 35 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title