Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRC56 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17062620UL
Description
LRRC56 Polyclonal specifically detects LRRC56 in Human samples. It is validated for Western Blot.Specifications
LRRC56 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
leucine rich repeat containing 56 | |
Rabbit | |
Affinity Purified | |
RUO | |
115399 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
LRRC56 | |
Synthetic peptides corresponding to LRRC56(leucine rich repeat containing 56) The peptide sequence was selected from the N terminal of LRRC56. Peptide sequence LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL. | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title