LRRC56 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170626

Catalog No. NBP170626

Description

LRRC56 Polyclonal specifically detects LRRC56 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LRRC56
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: leucine rich repeat containing 56
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 115399
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: LRRC56
• Immunogen: Synthetic peptides corresponding to LRRC56(leucine rich repeat containing 56) The peptide sequence was selected from the N terminal of LRRC56. Peptide sequence LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Bovine: 92%; Guinea pig: 92%; Rat: 92%; Canine: 85%; Equine: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG