Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRC57 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | LRRC57 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156793
|
Novus Biologicals
NBP156793 |
100 μL |
Each of 1 for $436.00
|
|
Description
LRRC57 Polyclonal specifically detects LRRC57 in Human samples. It is validated for Western Blot.Specifications
LRRC57 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZp686H1865, FLJ36812, leucine rich repeat containing 57, leucine-rich repeat-containing protein 57 | |
LRRC57 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q8N9N7 | |
255252 | |
Synthetic peptides corresponding to LRRC57(leucine rich repeat containing 57) The peptide sequence was selected from the middle region of LRRC57. Peptide sequence NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title