Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRC8B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | LRRC8B |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159628
|
Novus Biologicals
NBP159628 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
LRRC8B Polyclonal specifically detects LRRC8B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| LRRC8B | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 23507 | |
| Synthetic peptides corresponding to LRRC8B(leucine rich repeat containing 8 family, member B) The peptide sequence was selected from the middle region of LRRC8B. Peptide sequence TLYLKSSLSRIPQVVTDLLPSLQKLSLDNEGSKLVVLNNLKKMVNLKSLE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| KIAA0231TA-LRRPleucine-rich repeat-containing protein 8B, leucine rich repeat containing 8 family, member B, MGC42220, T cell activation leucine repeat rich protein, TALRRP, T-cell activation leucine repeat-rich protein | |
| LRRC8B | |
| IgG | |
| Affinity Purified | |
| 92 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title