Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRN4CL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16010520UL
Description
LRRN4CL Polyclonal specifically detects LRRN4CL in Human samples. It is validated for Western Blot.Specifications
LRRN4CL | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8ND94 | |
LRRN4CL | |
Synthetic peptides corresponding to LOC221091 The peptide sequence was selected from the middle region of LOC221091. Peptide sequence PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
LRRN4 C-terminal like, LRRN4 C-terminal-like protein, MGC61707 | |
Rabbit | |
Affinity Purified | |
RUO | |
221091 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction