Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRN4CL Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | LRRN4CL |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16010520
|
Novus Biologicals
NBP16010520UL |
20 μL |
Each for $152.22
|
|
NBP160105
|
Novus Biologicals
NBP160105 |
100 μL |
Each for $436.00
|
|
Description
LRRN4CL Polyclonal specifically detects LRRN4CL in Human samples. It is validated for Western Blot.Specifications
LRRN4CL | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
LRRN4 C-terminal like, LRRN4 C-terminal-like protein, MGC61707 | |
LRRN4CL | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q8ND94 | |
221091 | |
Synthetic peptides corresponding to LOC221091 The peptide sequence was selected from the middle region of LOC221091. Peptide sequence PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title