Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LRRN4CL Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen LRRN4CL
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16010520
View Documents
Novus Biologicals
NBP16010520UL
20 μL
Each for $152.22
Add to cart
 
NBP160105
View Documents
Novus Biologicals
NBP160105
100 μL
Each for $436.00
Add to cart
 
Description

Description

LRRN4CL Polyclonal specifically detects LRRN4CL in Human samples. It is validated for Western Blot.
Specifications

Specifications

LRRN4CL
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
LRRN4 C-terminal like, LRRN4 C-terminal-like protein, MGC61707
LRRN4CL
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q8ND94
221091
Synthetic peptides corresponding to LOC221091 The peptide sequence was selected from the middle region of LOC221091. Peptide sequence PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit