Invitrogen™ LRTOMT Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA5114402

Catalog No. PIPA5114402

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human placenta tissue, human MCF-7 whole cell, human Hela whole cell, human Caco-2 whole cell, human K562 whole cell, human U20S whole cell, human THP-1 whole cell, rat brain tissue, rat ovarian tissue, rat heart tissue, rat lung tissue, mouse brain tissue, mouse lung tissue. IHC: human placenta tissue, human Lung cancer tissue, mouse brain tissue, mouse brain tissue, rat brain tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Required for auditory function.

Specifications

• Antigen: LRTOMT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: LRTOMT
• Gene Alias: 1700008D07Rik; Catechol O-methyltransferase 2; catechol O-methyltransferase 2 {ECO:0000250; CFAP111; Comt2; DFNB63; leucine rich repeat containing 51; leucine rich transmembrane and 0-methyltransferase domain containing; leucine rich transmembrane and O-methyltransferase domain containing; leucine-rich repeat-containing protein 51; leucine-rich repeat-containing protein 51 {ECO:0000312; leucine-rich repeat-containing protein 51; transmembrane O-methyltransferase; LRRC51; lrrc51 {ECO:0000312; Lrtomt; Lrtomt1; O-methyltransferase domain containing; PP7517; Protein LRTOMT1; protein LRTOMT2; RGD:1561509}; RGD:1565856}; RGD1561509; RGD1565856; Tomt; tomt {ECO:0000312; Transmembrane O-methyltransferase; transmembrane O-methyltransferase {ECO:0000312; Transmembrane O-methyltransferase homolog; UniProtKB:A1Y9I9}
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 220074, 293156, 308868, 69358
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: B6CZ61, B6CZ62, Q8WZ04, Q9DAK8
• Gene Symbols: Lrrc51, LRTOMT
• Immunogen: A synthetic peptide corresponding to a sequence of human LRTOMT (RLLTVERDPRTAAVAEKLIRLAGFDEHMVEL).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov