Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LST3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | LST3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159483
|
Novus Biologicals
NBP159483 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
LST3 Polyclonal specifically detects LST3 in Human samples. It is validated for Western Blot.Specifications
| LST3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q71QF0 | |
| 338821 | |
| Synthetic peptides corresponding to LST-3TM12(organic anion transporter LST-3b) The peptide sequence was selected from the middle region of LST-3TM12. Peptide sequence RAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| liver-specific organic anion transporter 3, liver-specific organic anion transporter 3TM12, LST3, organic anion transporter LST-3b | |
| SLCO1B7 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title