Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LUC7L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen LUC7L
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179694
View Documents
Novus Biologicals
NBP179694
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

LUC7L Polyclonal specifically detects LUC7L in Human samples. It is validated for Western Blot.
Specifications

Specifications

LUC7L
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ10231, hLuc7B1, Luc7, LUC7 (S. cerevisiae)-like, LUC7B1, LUC7L1, LUC7-LIKE, LUC7-like (S. cerevisiae), putative RNA-binding protein Luc7-like 1, Putative SR protein LUC7B1, sarcoplasmic reticulum protein LUC7B1, SR+89
LUC7L
IgG
Affinity Purified
44 kDa
Western Blot
Unconjugated
RUO
NP_958815
55692
Synthetic peptide directed towards the N terminal of human LUC7LThe immunogen for this antibody is LUC7L. Peptide sequence YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit