Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LUC7L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | LUC7L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179694
|
Novus Biologicals
NBP179694 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
LUC7L Polyclonal specifically detects LUC7L in Human samples. It is validated for Western Blot.Specifications
| LUC7L | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ10231, hLuc7B1, Luc7, LUC7 (S. cerevisiae)-like, LUC7B1, LUC7L1, LUC7-LIKE, LUC7-like (S. cerevisiae), putative RNA-binding protein Luc7-like 1, Putative SR protein LUC7B1, sarcoplasmic reticulum protein LUC7B1, SR+89 | |
| LUC7L | |
| IgG | |
| Affinity Purified | |
| 44 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_958815 | |
| 55692 | |
| Synthetic peptide directed towards the N terminal of human LUC7LThe immunogen for this antibody is LUC7L. Peptide sequence YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title