Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LUC7L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $349.40

Specifications

Antigen LUC7L
Immunogen Synthetic peptide directed towards the middle region of human LUC7LThe immunogen for this antibody is LUC7L. Peptide sequence EEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPAS.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17969520
View Documents
Novus Biologicals
NBP17969520UL
20ul
Each for $152.22
Add to cart
 
NBP179695
View Documents
Novus Biologicals
NBP179695
100 ul
Each for $349.40
Add to cart
 
Description

Description

LUC7L Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

LUC7L
Rabbit
Polyclonal
Unconjugated
55692
Affinity Purified
Western Blot
RUO
Synthetic peptide directed towards the middle region of human LUC7LThe immunogen for this antibody is LUC7L. Peptide sequence EEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPAS.
Primary
IgG
FLJ10231, hLuc7B1, Luc7, LUC7 (S. cerevisiae)-like, LUC7B1, LUC7L1, LUC7-LIKE, LUC7-like (S. cerevisiae), putative RNA-binding protein Luc7-like 1, Putative SR protein LUC7B1, sarcoplasmic reticulum protein LUC7B1, SR+89
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
SDS
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit