Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LZTS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | LZTS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158275
|
Novus Biologicals
NBP158275 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
LZTS2 Polyclonal specifically detects LZTS2 in Human samples. It is validated for Western Blot.Specifications
| LZTS2 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| Q9BRK4 | |
| 84445 | |
| Synthetic peptides corresponding to LZTS2(leucine zipper, putative tumor suppressor 2) The peptide sequence was selected from the N terminal of LZTS2. Peptide sequence EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| hLZTS2, KIAA1813leucine zipper putative tumor suppressor 2, LAPSER1Protein LAPSER1, leucine zipper, putative tumor suppressor 2 | |
| LZTS2 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title