Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LZTS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen LZTS2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP158275
View Documents
Novus Biologicals
NBP158275
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

LZTS2 Polyclonal specifically detects LZTS2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

LZTS2
Polyclonal
Rabbit
Cell Cycle and Replication
Q9BRK4
84445
Synthetic peptides corresponding to LZTS2(leucine zipper, putative tumor suppressor 2) The peptide sequence was selected from the N terminal of LZTS2. Peptide sequence EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
hLZTS2, KIAA1813leucine zipper putative tumor suppressor 2, LAPSER1Protein LAPSER1, leucine zipper, putative tumor suppressor 2
LZTS2
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit