Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MafA Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen MafA
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123397
View Documents
Novus Biologicals
NBP309248100UL
100 μg
Each for $320.71
Add to cart
 
NB123398
View Documents
Novus Biologicals
NBP30924825UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

MafA Polyclonal antibody specifically detects MafA in Human, Mouse samples. It is validated for Western Blot
Specifications

Specifications

MafA
Western Blot
Purified
RUO
Human, Mouse
hMafA, Pancreatic beta-cell-specific transcriptional activator, RIPE3B1, transcription factor MafA, Transcription factor RIPE3b1, V-maf musculoaponeurotic fibrosarcoma oncogene homolog A, v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian)
The immunogen is a synthetic peptide directed towards the N terminal region of human MafA (NP_963883). Peptide sequence KPALEDLYWMSGYQHHLNPEALNLTPEDAVEALIGSGHHGAHHGAHHPAA
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Diabetes Research, Lipid and Metabolism, Transcription Factors and Regulators
PBS buffer, 2% sucrose
389692
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit