MAGEA3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP15640420UL

Catalog No. NBP15640420

Description

MAGEA3 Polyclonal specifically detects MAGEA3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MAGEA3
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 4-8 ug/ml, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: P43357
• Gene Symbols: MAGEA3
• Immunogen: Synthetic peptides corresponding to MAGEA3(melanoma antigen family A, 3) The peptide sequence was selected from the middle region of MAGEA3. Peptide sequence APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD.
• Quantity: 20 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 4102
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Antigen MZ2-D, Cancer/testis antigen 1.3, CT1.3 MAGE-3 antigen, HIP8, MAGE3 MAGEA6, melanoma antigen family A, 3, melanoma-associated antigen 3, member 3, MGC14613
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG