Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MAGEA3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$152.22 - $493.00

Specifications

Antigen MAGEA3
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15640420
View Documents
Novus Biologicals
NBP15640420UL
20 μL
Each for $152.22
Add to cart
 
NBP156404
View Documents
Novus Biologicals
NBP156404
100 μL
Each for $493.00
Add to cart
 
Description

Description

MAGEA3 Polyclonal specifically detects MAGEA3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

MAGEA3
Polyclonal
Rabbit
Cancer
PBS and 2% Sucrose with 0.09% Sodium Azide
Antigen MZ2-D, Cancer/testis antigen 1.3, CT1.3 MAGE-3 antigen, HIP8, MAGE3 MAGEA6, melanoma antigen family A, 3, melanoma-associated antigen 3, member 3, MGC14613
MAGEA3
IgG
Affinity Purified
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
Human
P43357
4102
Synthetic peptides corresponding to MAGEA3(melanoma antigen family A, 3) The peptide sequence was selected from the middle region of MAGEA3. Peptide sequence APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit