Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MAGEA6 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | MAGEA6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156603
|
Novus Biologicals
NBP156603 |
100 μL |
Each of 1 for $436.00
|
|
Description
MAGEA6 Polyclonal specifically detects MAGEA6 in Human samples. It is validated for Western Blot.Specifications
MAGEA6 | |
Polyclonal | |
Rabbit | |
Cancer | |
P43360 | |
4105 | |
Synthetic peptides corresponding to MAGEA6(melanoma antigen family A, 6) The peptide sequence was selected from the middle region of MAGEA6. Peptide sequence APEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSD. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CT1.6MGC52297, MAGE-3b, MAGE3B, MAGE3B antigen, MAGE6member 6, melanoma antigen family A, 6, melanoma-associated antigen 6 | |
MAGEA6 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title