Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MAGEB3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | MAGEB3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156934
|
Novus Biologicals
NBP156934 |
100 μL |
Each of 1 for $436.00
|
|
Description
MAGEB3 Polyclonal specifically detects MAGEB3 in Human samples. It is validated for Western Blot.Specifications
MAGEB3 | |
Polyclonal | |
Rabbit | |
Human | |
O15480 | |
4114 | |
Synthetic peptides corresponding to MAGEB3(melanoma antigen family B, 3) The peptide sequence was selected from the N terminal of MAGEB3. Peptide sequence KKKVSFSSPLILGATIQKKSAGRSRSALKKPQRALSTTTSVDVSYKKSYK. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CT3.5, MAGE-B3 antigen, melanoma antigen family B, 3, melanoma-associated antigen B3, member 5 | |
MAGEB3 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title