Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Magmas Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Magmas |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Magmas Polyclonal specifically detects Magmas in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Magmas | |
Polyclonal | |
Rabbit | |
Human | |
MAGMAS, mitochondria associated protein involved in granulocyte macrophage colonystimulating factor signal transduction, Mitochondria-associated granulocyte macrophage CSF-signaling molecule, mitochondrial import inner membrane translocase subunit TIM16, presequence translocase-associated motor 16 homolog (S. cerevisiae), Presequence translocated-associated motor subunit PAM16, TIM16, TIMM16magmas-like protein | |
PAM16 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
51025 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title